PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa010230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family CAMTA
Protein Properties Length: 1059aa    MW: 119300 Da    PI: 5.8099
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-8188PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1179.73.5e-56201362118
       CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywl 101
                l+ ++rwl++ ei++iL n++k+++++e+ +rp++gsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+++vl+cyYah+e+n++fqrr+ywl
  Lsa010230  20 LEAQHRWLRPAEICEILRNYTKFRIASEPGNRPPNGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSIDVLHCYYAHGEDNENFQRRSYWL 119
                5679************************************************************************************************ PP

       CG-1 102 Leeelekivlvhylevk 118
                Leeel++ivlvhy+evk
  Lsa010230 120 LEEELSNIVLVHYREVK 136
                **************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143781.40315141IPR005559CG-1 DNA-binding domain
SMARTSM010762.5E-7918136IPR005559CG-1 DNA-binding domain
PfamPF038598.7E-4921134IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:1.25.40.203.3E-1687108IPR020683Ankyrin repeat-containing domain
SuperFamilySSF812962.18E-16484569IPR014756Immunoglobulin E-set
Gene3DG3DSA:2.60.40.103.6E-4484559IPR013783Immunoglobulin-like fold
PfamPF018331.5E-4484557IPR002909IPT domain
CDDcd002044.15E-12668770No hitNo description
SuperFamilySSF484037.31E-15670771IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.3E-16673770IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029716.68679764IPR020683Ankyrin repeat-containing domain
PfamPF127965.7E-7684765IPR020683Ankyrin repeat-containing domain
SMARTSM002480.0082712741IPR002110Ankyrin repeat
PROSITE profilePS500889.885712744IPR002110Ankyrin repeat
SMARTSM00248700751780IPR002110Ankyrin repeat
SMARTSM0001530879901IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.565880909IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525402.52E-7882930IPR027417P-loop containing nucleoside triphosphate hydrolase
PfamPF006120.18882900IPR000048IQ motif, EF-hand binding site
SMARTSM000151.7E-4902924IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.816903927IPR000048IQ motif, EF-hand binding site
PfamPF006121.1E-4905924IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1059 aa     Download sequence    Send to blast
MAEARRYALA AQLDIDQILL EAQHRWLRPA EICEILRNYT KFRIASEPGN RPPNGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKAGSIDVLH CYYAHGEDNE NFQRRSYWLL  120
EEELSNIVLV HYREVKGSRT NTNRVREVGE ATPNSLESEE NISSSEVDSS VSSKFRTFNY  180
PVASQTTENS TQASEYEDAE SAYSHQSTSR YGSILNLQPK TDDQLSMPYY PAPPSNDYDA  240
KFQVNPDMSF VSLMQGGKID NNPDAGFTYK PQKNLDMPAW DNDFEGYQST HLSTQPYNPN  300
ILTHGNEMPR QIMPDGSNKM QEFRGNPGWQ LDGPYNVPSR FQEELSYAEI FKAFESNDTI  360
DHNNPLITQI NMESHVTNED GGRHLQPNLE SNPNPSVDEK PGSLKSPFLE GFKKEGIKKL  420
DSFDRWMSKE LGDVKESQTQ STSGTYWEAV ESENGVDDSI ISPQVHLDTY VLGPSLSQDQ  480
LFSIIDFSPN WAYAGSEIKV LVTGRFLRSQ QELQHCEWAC MFGELEVPAE VVADGVLRCY  540
TPGHKSGRVH FYVTCSNRVA CSEVREFEFK VNENLSQDMD GVQDINADNS NGTLLHMRFV  600
KLLSLGPETA RNSARSVVDP ELLNQLSRLI QEDDREWEQY PSEKAQNQLL ERLLKEKLYA  660
WLIHKVGEGG KGPSVLDEGG QGVLHFAAAL GYDWAIPATV AAGVSINFRD VNGWTALHWA  720
ASCGRERTVA FLISEGALAG ALTDPSPTYP SGRTPADLAS ANGDKGIAGY CAEAALSTHL  780
EQLKLKDRDS KAKAVQTVSE RTPTPPGYGD RPQGLSLKDS LAAVCNATQA AARIHQVFRV  840
QSFQKKQMKG GEFEMTEERA VSMALKSSRM GGQHDEPVHA AAAAVRIQNK FRSWKGRKDF  900
LMMRQRIVKI QAHVRGHQVR KNYKKIVWSV GILDKVILRW RRKGSGLRGF KPEPVAEGST  960
STTTTVAKSG KEEDDDFFKE GRKQTEQRLQ KALARVKSMV QYPEARDQYR RLLNVVNDMQ  1020
ESKAVYDKAL ESSEEAIDFD EDLIDLDALL DDDDAFMNI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010645223.10.0PREDICTED: calmodulin-binding transcription activator 3
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLA0A103XCC70.0A0A103XCC7_CYNCS; Ankyrin repeat-containing protein
STRINGVIT_07s0141g00250.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1